Recombinant Human WNT7B protein, StrepII/His-tagged

• Cat.No.: WNT7B-241H
• Product Overview: Recombinant Human WNT7B(32-349a.a.) fused with StrepII tag at N-terminus and His tag at C-terminus was expressed in HEK293.

Specification

• Description: Wnt7B is a ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues.
• Source: HEK293
• Species: Human
• Tag: His&StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Molecular Mass: 35.7 kDa
• AA Sequence: LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAAC SQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLP KFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQY TKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
• Endotoxin: <0.1 EU per ug protein by LAL method
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20 centigrade as supplied; 1 month at 4 centigrade after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute with 20ul PBS to a concentration of 0.1 mg/ml.
• Protein length: 32-349 a.a.

Gene Information

• Gene Name: WNT7B wingless-type MMTV integration site family, member 7B [ Homo sapiens ]
• Official Symbol: WNT7B
• Synonyms: WNT7B; wingless-type MMTV integration site family, member 7B; protein Wnt-7b
• Gene ID: 7477
• mRNA Refseq: NM_058238
• Protein Refseq: NP_478679
• MIM: 601967
• UniProt ID: P56706
• Chromosome Location: 22q13
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: extracellular matrix structural constituent; frizzled binding; receptor binding