Recombinant Human WNT7B protein, StrepII/His-tagged

Cat.No. : WNT7B-241H
Product Overview : Recombinant Human WNT7B(32-349a.a.) fused with StrepII tag at N-terminus and His tag at C-terminus was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&Strep II
Protein Length : 32-349 a.a.
Description : Wnt7B is a ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Molecular Mass : 35.7 kDa
AA Sequence : LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAAC SQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLP KFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQY TKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Endotoxin : <0.1 EU per ug protein by LAL method
Purity : >80% pure by SDS-PAGE
Storage : 12 months at -20 centigrade as supplied; 1 month at 4 centigrade after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute with 20ul PBS to a concentration of 0.1 mg/ml.
Gene Name WNT7B wingless-type MMTV integration site family, member 7B [ Homo sapiens ]
Official Symbol WNT7B
Synonyms WNT7B; wingless-type MMTV integration site family, member 7B; protein Wnt-7b;
Gene ID 7477
mRNA Refseq NM_058238
Protein Refseq NP_478679
MIM 601967
UniProt ID P56706
Chromosome Location 22q13
Pathway Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function extracellular matrix structural constituent; frizzled binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WNT7B Products

Required fields are marked with *

My Review for All WNT7B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon