Recombinant Human WNT7B protein, StrepII/His-tagged
Cat.No. : | WNT7B-241H |
Product Overview : | Recombinant Human WNT7B(32-349a.a.) fused with StrepII tag at N-terminus and His tag at C-terminus was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&Strep II |
Protein Length : | 32-349 a.a. |
Description : | Wnt7B is a ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
Molecular Mass : | 35.7 kDa |
AA Sequence : | LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAAC SQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLP KFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQY TKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
Endotoxin : | <0.1 EU per ug protein by LAL method |
Purity : | >80% pure by SDS-PAGE |
Storage : | 12 months at -20 centigrade as supplied; 1 month at 4 centigrade after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute with 20ul PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT7B wingless-type MMTV integration site family, member 7B [ Homo sapiens ] |
Official Symbol | WNT7B |
Synonyms | WNT7B; wingless-type MMTV integration site family, member 7B; protein Wnt-7b; |
Gene ID | 7477 |
mRNA Refseq | NM_058238 |
Protein Refseq | NP_478679 |
MIM | 601967 |
UniProt ID | P56706 |
Chromosome Location | 22q13 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | extracellular matrix structural constituent; frizzled binding; receptor binding; |
◆ Recombinant Proteins | ||
WNT7B-2291H | Recombinant Human WNT7B Protein (25-349 aa), His-SUMO-Myc-tagged | +Inquiry |
WNT7B-16H | Recombinant Human WNT7B protein, GST-tagged | +Inquiry |
WNT7B-2786H | Recombinant Human WNT7B Protein (25-349 aa), His-Myc-tagged | +Inquiry |
WNT7B-122H | Recombinant Human WNT7B Protein | +Inquiry |
WNT7B-15H | Recombinant Human WNT7B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT7B-288HCL | Recombinant Human WNT7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT7B Products
Required fields are marked with *
My Review for All WNT7B Products
Required fields are marked with *
0
Inquiry Basket