Recombinant Mouse WNT7B Protein (25-349 aa), His-SUMO-Myc-tagged

Cat.No. : WNT7B-2310M
Product Overview : Recombinant Mouse WNT7B Protein (25-349 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Stem Cells. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
Source : E. coli
Species : Mouse
Tag : His&Myc&SUMO
Form : Tris-based buffer,50% glycerol
Molecular Mass : 56.3 kDa
Protein length : 25-349 aa
AA Sequence : ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Wnt7b wingless-related MMTV integration site 7B [ Mus musculus ]
Official Symbol WNT7B
Synonyms WNT7B; wingless-related MMTV integration site 7B; protein Wnt-7b; Wnt-7b;
Gene ID 22422
mRNA Refseq NM_001163633
Protein Refseq NP_001157105
UniProt ID P28047

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WNT7B Products

Required fields are marked with *

My Review for All WNT7B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon