Recombinant Human WNT5B protein, His-tagged
Cat.No. : | WNT5B-3053H |
Product Overview : | Recombinant Human WNT5B protein(128-267 aa), fused to His tag, was expressed in E. coli. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 128-267 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKGRLELVN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | WNT5B wingless-type MMTV integration site family, member 5B [ Homo sapiens ] |
Official Symbol | WNT5B |
Synonyms | WNT5B; wingless-type MMTV integration site family, member 5B; protein Wnt-5b; WNT-5B protein; MGC2648; |
Gene ID | 81029 |
mRNA Refseq | NM_030775 |
Protein Refseq | NP_110402 |
MIM | 606361 |
UniProt ID | Q9H1J7 |
◆ Recombinant Proteins | ||
WNT5B-207H | Recombinant Human WNT5B, StrepII-tagged | +Inquiry |
WNT5B-10199M | Recombinant Mouse WNT5B Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT5B-3289C | Recombinant Chicken WNT5B | +Inquiry |
WNT5B-8578Z | Recombinant Zebrafish WNT5B | +Inquiry |
WNT5B-773H | Active Recombinant Human WNT5B | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT5B-291HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
WNT5B-292HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT5B Products
Required fields are marked with *
My Review for All WNT5B Products
Required fields are marked with *
0
Inquiry Basket