Recombinant Human WNT5B, StrepII-tagged

• Cat.No.: WNT5B-207H
• Product Overview: Purified, full-length human recombinant WNT5B protein (amino acids 18-359, 342 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.5 kDa. (Accession NP_110402.2; UniProt Q9H1J7)

Specification

• Description: Wnt5B is a ligand for members of the frizzled family of seven transmembrane receptors. It is a probable developmental protein and may be a signaling molecule which affects the development of discrete regions of tissues. It is likely to signal over only few cell diameters. The protein belongs to the Wnt family.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 18-359, 342 a.a.
• AA Sequence: QLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRW NCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEY GYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVG DRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELM CCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: WNT5B wingless-type MMTV integration site family, member 5B [ Homo sapiens ]
• Official Symbol: WNT5B
• Synonyms: WNT5B; wingless-type MMTV integration site family, member 5B; protein Wnt-5b; WNT-5B protein; MGC2648
• Gene ID: 81029
• mRNA Refseq: NM_030775
• Protein Refseq: NP_110402
• MIM: 606361
• UniProt ID: Q9H1J7
• Chromosome Location: 12p13.3
• Pathway: Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem
• Function: frizzled-2 binding; receptor binding