Recombinant Human WNT5B, StrepII-tagged
Cat.No. : | WNT5B-207H |
Product Overview : | Purified, full-length human recombinant WNT5B protein (amino acids 18-359, 342 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.5 kDa. (Accession NP_110402.2; UniProt Q9H1J7) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 18-359, 342 a.a. |
Description : | Wnt5B is a ligand for members of the frizzled family of seven transmembrane receptors. It is a probable developmental protein and may be a signaling molecule which affects the development of discrete regions of tissues. It is likely to signal over only few cell diameters. The protein belongs to the Wnt family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | QLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRW NCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEY GYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVG DRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELM CCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT5B wingless-type MMTV integration site family, member 5B [ Homo sapiens ] |
Official Symbol | WNT5B |
Synonyms | WNT5B; wingless-type MMTV integration site family, member 5B; protein Wnt-5b; WNT-5B protein; MGC2648; |
Gene ID | 81029 |
mRNA Refseq | NM_030775 |
Protein Refseq | NP_110402 |
MIM | 606361 |
UniProt ID | Q9H1J7 |
Chromosome Location | 12p13.3 |
Pathway | Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem; |
Function | frizzled-2 binding; receptor binding; |
◆ Recombinant Proteins | ||
WNT5B-18574M | Recombinant Mouse WNT5B Protein | +Inquiry |
Wnt5b-303M | Active Recombinant Mouse Wnt5b | +Inquiry |
WNT5B-1478C | Recombinant Cattle WNT5B protein, His & T7-tagged | +Inquiry |
WNT5B-587H | Recombinant Human WNT5B Protein, His&GST-tagged | +Inquiry |
WNT5B-3053H | Recombinant Human WNT5B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT5B-292HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
WNT5B-291HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT5B Products
Required fields are marked with *
My Review for All WNT5B Products
Required fields are marked with *
0
Inquiry Basket