Recombinant Human WNT3A, StrepII-tagged

• Cat.No.: WNT3A-265H
• Product Overview: Purified, full-length human recombinant WNT3A protein (amino acids 19-352, 334 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.4 kDa. (Accession NP_149122.1; UniProt P56704)

Specification

• Description: WNT3A is a member of the WNT gene family. It plays distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Palmitoylation at Ser-209 is required for efficient binding to frizzled receptors. It is also required for subsequent palmitoylation at Cys-77. Palmitoylation is necessary for proper trafficking to cell surface.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 19-352, 334 a.a.
• AA Sequence: SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHD SLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSRE FADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVV EKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNA RAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: WNT3A wingless-type MMTV integration site family, member 3A [ Homo sapiens ]
• Official Symbol: WNT3A
• Synonyms: WNT3A; wingless-type MMTV integration site family, member 3A; protein Wnt-3a; MGC119418; MGC119419; MGC119420
• Gene ID: 89780
• mRNA Refseq: NM_033131
• Protein Refseq: NP_149122
• MIM: 606359
• UniProt ID: P56704
• Chromosome Location: 1q42
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem
• Function: extracellular matrix structural constituent; frizzled-2 binding; protein binding; protein domain specific binding; receptor agonist activity; transcription coactivator activity