Recombinant Human WNT3A, StrepII-tagged
Cat.No. : | WNT3A-265H |
Product Overview : | Purified, full-length human recombinant WNT3A protein (amino acids 19-352, 334 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.4 kDa. (Accession NP_149122.1; UniProt P56704) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 19-352, 334 a.a. |
Description : | WNT3A is a member of the WNT gene family. It plays distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Palmitoylation at Ser-209 is required for efficient binding to frizzled receptors. It is also required for subsequent palmitoylation at Cys-77. Palmitoylation is necessary for proper trafficking to cell surface. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHD SLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSRE FADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVV EKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNA RAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT3A wingless-type MMTV integration site family, member 3A [ Homo sapiens ] |
Official Symbol | WNT3A |
Synonyms | WNT3A; wingless-type MMTV integration site family, member 3A; protein Wnt-3a; MGC119418; MGC119419; MGC119420; |
Gene ID | 89780 |
mRNA Refseq | NM_033131 |
Protein Refseq | NP_149122 |
MIM | 606359 |
UniProt ID | P56704 |
Chromosome Location | 1q42 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; |
Function | extracellular matrix structural constituent; frizzled-2 binding; protein binding; protein domain specific binding; receptor agonist activity; transcription coactivator activity; |
◆ Recombinant Proteins | ||
WNT3A-457H | Recombinant Human WNT3A protein | +Inquiry |
WNT3A-185H | Recombinant Human WNT3A protein | +Inquiry |
Wnt3a-1050M | Recombinant Mouse Wnt3a Protein, His-tagged | +Inquiry |
WNT3A-6678H | Recombinant Human WNT3A Protein (Met1-Cys351), C-His tagged | +Inquiry |
WNT3A-1660Z | Recombinant Zebrafish WNT3A | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT3A-295HCL | Recombinant Human WNT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT3A Products
Required fields are marked with *
My Review for All WNT3A Products
Required fields are marked with *
0
Inquiry Basket