Recombinant Human WFS1 protein, GST-tagged
Cat.No. : | WFS1-3646H |
Product Overview : | Recombinant Human WFS1 protein(1-95 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-95 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | WFS1 Wolfram syndrome 1 (wolframin) [ Homo sapiens ] |
Official Symbol | WFS1 |
Synonyms | WFS1; Wolfram syndrome 1 (wolframin); DFNA6, DFNA14, DFNA38; wolframin; DIDMOAD; WFS; WFRS; WFSL; FLJ51211; |
mRNA Refseq | NM_001145853 |
Protein Refseq | NP_001139325 |
MIM | 606201 |
UniProt ID | O76024 |
Gene ID | 7466 |
◆ Recombinant Proteins | ||
WFS1-577H | Recombinant Human WFS1 Protein, His-tagged | +Inquiry |
WFS1-3288H | Recombinant Human WFS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WFS1-6412H | Recombinant Human WFS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WFS1-3646H | Recombinant Human WFS1 protein, GST-tagged | +Inquiry |
WFS1-852HFL | Recombinant Full Length Human WFS1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFS1-316HCL | Recombinant Human WFS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WFS1 Products
Required fields are marked with *
My Review for All WFS1 Products
Required fields are marked with *
0
Inquiry Basket