Recombinant Human VPS4A protein, His&Myc-tagged

• Cat.No.: VPS4A-6744H
• Product Overview: Recombinant Human VPS4A protein(Q9UN37)(1-437aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-437a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.9 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES

Gene Information

• Gene Name: VPS4A vacuolar protein sorting 4 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: VPS4A
• Synonyms: VPS4A; vacuolar protein sorting 4 homolog A (S. cerevisiae); vacuolar protein sorting 4A (yeast homolog) , vacuolar protein sorting 4A (yeast); vacuolar protein sorting-associated protein 4A; FLJ22197; SKD1; SKD1A; SKD2; VPS4; VPS4 1; hVPS4; SKD1-homolog; vacuolar sorting protein 4; vacuolar protein sorting factor 4A; VPS4-1
• Gene ID: 27183
• mRNA Refseq: NM_013245
• Protein Refseq: NP_037377
• MIM: 609982
• UniProt ID: Q9UN37