Recombinant Human VPS4A protein, GST-tagged
Cat.No. : | VPS4A-301457H |
Product Overview : | Recombinant Human VPS4A (86-437 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys86-Ser437 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | KENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | VPS4A vacuolar protein sorting 4 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VPS4A |
Synonyms | VPS4A; vacuolar protein sorting 4 homolog A (S. cerevisiae); vacuolar protein sorting 4A (yeast homolog) , vacuolar protein sorting 4A (yeast); vacuolar protein sorting-associated protein 4A; FLJ22197; SKD1; SKD1A; SKD2; VPS4; VPS4 1; hVPS4; SKD1-homolog; vacuolar sorting protein 4; vacuolar protein sorting factor 4A; VPS4-1; |
Gene ID | 27183 |
mRNA Refseq | NM_013245 |
Protein Refseq | NP_037377 |
MIM | 609982 |
UniProt ID | Q9UN37 |
◆ Recombinant Proteins | ||
VPS4A-3913H | Recombinant Human VPS4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Vps4a-572M | Recombinant Mouse Vps4a Protein, MYC/DDK-tagged | +Inquiry |
VPS4A-10072M | Recombinant Mouse VPS4A Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS4A-6744H | Recombinant Human VPS4A protein, His&Myc-tagged | +Inquiry |
VPS4A-5172R | Recombinant Rhesus monkey VPS4A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS4A-1914HCL | Recombinant Human VPS4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VPS4A Products
Required fields are marked with *
My Review for All VPS4A Products
Required fields are marked with *
0
Inquiry Basket