Recombinant Human VPS18 protein, His-tagged
| Cat.No. : | VPS18-20H |
| Product Overview : | Recombinant Human VPS18 protein(Arg821-Leu970), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | N-SUMO & C-His |
| Protein length : | Arg821-Leu970 |
| Form : | Phosphate buffered saline |
| AASequence : | REMEEATASAQRIRRDLQELRGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQRKLGAAPPPAKGSARAKEAEGGAATAGPSREQLKADLDELVAAECVYCGELMIRSIDRPFIDPQRYEEEQL |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | VPS18 vacuolar protein sorting 18 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | VPS18 |
| Synonyms | VPS18; vacuolar protein sorting 18 homolog (S. cerevisiae); vacuolar protein sorting protein 18; vacuolar protein sorting-associated protein 18 homolog; KIAA1475; PEP3; hVPS18; |
| Gene ID | 57617 |
| mRNA Refseq | NM_020857 |
| Protein Refseq | NP_065908 |
| MIM | 608551 |
| UniProt ID | Q9P253 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VPS18 Products
Required fields are marked with *
My Review for All VPS18 Products
Required fields are marked with *
0
Inquiry Basket
