Recombinant Human VPS18 protein, His-tagged

• Cat.No.: VPS18-20H
• Product Overview: Recombinant Human VPS18 protein(Arg821-Leu970), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: Arg821-Leu970
• Tag: N-SUMO & C-His
• Form: Phosphate buffered saline
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: REMEEATASAQRIRRDLQELRGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQRKLGAAPPPAKGSARAKEAEGGAATAGPSREQLKADLDELVAAECVYCGELMIRSIDRPFIDPQRYEEEQL

Gene Information

• Gene Name: VPS18 vacuolar protein sorting 18 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: VPS18
• Synonyms: VPS18; vacuolar protein sorting 18 homolog (S. cerevisiae); vacuolar protein sorting protein 18; vacuolar protein sorting-associated protein 18 homolog; KIAA1475; PEP3; hVPS18
• Gene ID: 57617
• mRNA Refseq: NM_020857
• Protein Refseq: NP_065908
• MIM: 608551
• UniProt ID: Q9P253