Recombinant Human VIM protein, T7/His-tagged
Cat.No. : | VIM-203H |
Product Overview : | Recombinant human VIM (465aa, derived from BC000163) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPS TSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVR FLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQRE EAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDV RQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREM EENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLN LRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | VIM vimentin [ Homo sapiens ] |
Official Symbol | VIM |
Synonyms | VIM; vimentin; FLJ36605; |
Gene ID | 7431 |
mRNA Refseq | NM_003380 |
Protein Refseq | NP_003371 |
MIM | |
UniProt ID | P08670 |
Chromosome Location | 10p13 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Caspase-mediated cleavage of cytoskeletal proteins, organism-specific biosystem; |
Function | identical protein binding; protein C-terminus binding; protein binding; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
VIM-52H | Recombinant Human Vimentin | +Inquiry |
VIM-3160H | Recombinant Human VIM protein, His-tagged | +Inquiry |
VIM-4893H | Recombinant Human Vimentin, His-tagged | +Inquiry |
Vim-3755M | Recombinant Mouse Vim protein, His&Myc-tagged | +Inquiry |
VIM-3504C | Recombinant Chicken VIM | +Inquiry |
◆ Native Proteins | ||
WIM-5415B | Native Bovine Vimentin | +Inquiry |
VIM-186B | Native bovine VIM | +Inquiry |
◆ Cell & Tissue Lysates | ||
VIM-1907HCL | Recombinant Human VIM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VIM Products
Required fields are marked with *
My Review for All VIM Products
Required fields are marked with *
0
Inquiry Basket