Recombinant Human VHL protein, His-tagged

• Cat.No.: VHL-3754H
• Product Overview: Recombinant Human VHL protein(P40337)(1-213aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-213aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.2 kDa
• AA Sequence: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: VHL von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: VHL
• Synonyms: VHL; von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase; von Hippel Lindau syndrome , von Hippel Lindau tumor suppressor; von Hippel-Lindau disease tumor suppressor; VHL1; protein G7; elongin binding protein; RCA1; pVHL; HRCA1
• Gene ID: 7428
• mRNA Refseq: NM_000551
• Protein Refseq: NP_000542
• MIM: 608537
• UniProt ID: P40337