Recombinant Human VENTX Protein (1-258 aa), GST-tagged

Cat.No. : VENTX-2121H
Product Overview : Recombinant Human VENTX Protein (1-258 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-258 aa
Description : VENT homeobox homolog VENT-like homeobox protein 2.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 54.6 kDa
AA Sequence : MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name VENTX VENT homeobox [ Homo sapiens ]
Official Symbol VENTX
Synonyms VENTX; VENT homeobox; HPX42B; VENT-like homeobox 2; NA88A; VENTX2; MGC119910; MGC119911;
Gene ID 27287
mRNA Refseq NM_014468
Protein Refseq NP_055283
MIM 607158
UniProt ID O95231

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VENTX Products

Required fields are marked with *

My Review for All VENTX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon