Recombinant Human VEGFA Protein, GMP Grade, Animal-Free
| Cat.No. : | VEGFA-42HG |
| Product Overview : | GMP Recombinant Human VEGFA protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. |
| Source : | E. coli |
| Species : | Human |
| Molecular Mass : | 38.2 kDa |
| Protein length : | 165 amino acid |
| AA Sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ] |
| Official Symbol | VEGFA |
| Synonyms | VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609; |
| Gene ID | 7422 |
| mRNA Refseq | NM_001025366 |
| Protein Refseq | NP_001020537 |
| MIM | 192240 |
| UniProt ID | P15692 |
| BMP2-123H | GMP Recombinant Human BMP2 | +Inquiry |
| IFNA1-86H | Active GMP Recombinant Human IFNA1 protein | +Inquiry |
| IL1A-4315HG | GMP Recombinant Human IL1A protein | +Inquiry |
| IL1B-4316HG | GMP Recombinant Human IL1B protein | +Inquiry |
| IL2-4317HG | GMP Recombinant Human IL2 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
0
Inquiry Basket
