Recombinant Human VEGFA Protein, GMP Grade, Animal-Free

• Cat.No.: VEGFA-42HG
• Product Overview: GMP Recombinant Human VEGFA protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 165 amino acid
• Description: VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability.
• Molecular Mass: 38.2 kDa
• AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609
• Gene ID: 7422
• mRNA Refseq: NM_001025366
• Protein Refseq: NP_001020537
• MIM: 192240
• UniProt ID: P15692