Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
165 |
Description : |
Vascular Endothelial Growth Factor is a sub-family of growth factors produced by cells, which stimulates vasculogenesis and angiogenesis. VEGF's normal function is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. Mouse and rat express alternately spliced isoforms of 120, 164, and 188 amino acids (a.a.) in length. Recombinant mouse VEGF165 contains 165 amino acids residues (with a met at N-teminal) and it is a disulfide-linked homodimer. In addition, it shares 97 % a.a. sequence identity with corresponding regions of rat, 89 % with human and porcine, 88 % with bovine, and 90 % with feline, equine and canine VEGF, respectively. |
Form : |
Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
Molecular Mass : |
Approximately 38.8 kDa, a disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains with Met at N-terminus. |
AA Sequence : |
MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Endotoxin : |
Less than 1 EU/μg of rMuVEGF164 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |