Recombinant Human VCL protein(311-430 aa), C-His-tagged
Cat.No. : | VCL-2679H |
Product Overview : | Recombinant Human VCL protein(P18206)(311-430 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 311-430 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDD |
Gene Name | VCL vinculin [ Homo sapiens ] |
Official Symbol | VCL |
Synonyms | VCL; vinculin; metavinculin; MVCL; CMD1W; CMH15; |
Gene ID | 7414 |
mRNA Refseq | NM_003373 |
Protein Refseq | NP_003364 |
MIM | 193065 |
UniProt ID | P18206 |
◆ Recombinant Proteins | ||
VCL-6163R | Recombinant Rat VCL Protein, His (Fc)-Avi-tagged | +Inquiry |
VCL-01H | Recombinant Human VCL, His-tagged | +Inquiry |
VCL-6549H | Recombinant Human VCL Protein (Lys1020-Gln1134), N-His tagged | +Inquiry |
VCL-2679H | Recombinant Human VCL protein(311-430 aa), C-His-tagged | +Inquiry |
VCL-5283H | Recombinant Human VCL protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
VCL-899T | Native Turkey VCL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCL-900MCL | Recombinant Mouse VCL cell lysate | +Inquiry |
VCL-1687HCL | Recombinant Human VCL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VCL Products
Required fields are marked with *
My Review for All VCL Products
Required fields are marked with *
0
Inquiry Basket