Recombinant Human VAV3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | VAV3-6117H |
Product Overview : | VAV3 MS Standard C13 and N15-labeled recombinant protein (NP_001073343) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MPIFTFLSEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | VAV3 vav 3 guanine nucleotide exchange factor [ Homo sapiens (human) ] |
Official Symbol | VAV3 |
Synonyms | VAV3; vav 3 guanine nucleotide exchange factor; vav 3 oncogene; guanine nucleotide exchange factor VAV3; VAV-3; FLJ40431; |
Gene ID | 10451 |
mRNA Refseq | NM_001079874 |
Protein Refseq | NP_001073343 |
MIM | 605541 |
UniProt ID | Q9UKW4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All VAV3 Products
Required fields are marked with *
My Review for All VAV3 Products
Required fields are marked with *
0
Inquiry Basket