Recombinant Human VAV3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VAV3-6117H
Product Overview : VAV3 MS Standard C13 and N15-labeled recombinant protein (NP_001073343) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Molecular Mass : 32.4 kDa
AA Sequence : MPIFTFLSEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VAV3 vav 3 guanine nucleotide exchange factor [ Homo sapiens (human) ]
Official Symbol VAV3
Synonyms VAV3; vav 3 guanine nucleotide exchange factor; vav 3 oncogene; guanine nucleotide exchange factor VAV3; VAV-3; FLJ40431;
Gene ID 10451
mRNA Refseq NM_001079874
Protein Refseq NP_001073343
MIM 605541
UniProt ID Q9UKW4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VAV3 Products

Required fields are marked with *

My Review for All VAV3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon