Recombinant Human VASH1 protein, GST-tagged

• Cat.No.: VASH1-13H
• Product Overview: Recombinant Human VASH1(1 a.a. - 204 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-204 a.a.
• Description: VASH1 played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 48.2 kDa
• AA Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWE RMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPL TGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: VASH1 vasohibin 1 [ Homo sapiens ]
• Official Symbol: VASH1
• Synonyms: VASH1; vasohibin 1; KIAA1036; vasohibin-1
• Gene ID: 22846
• mRNA Refseq: NM_014909
• Protein Refseq: NP_055724
• MIM: 609011
• UniProt ID: Q7L8A9
• Chromosome Location: 14q24.3