Recombinant Human UXS1 protein, His-tagged
| Cat.No. : | UXS1-3638H |
| Product Overview : | Recombinant Human UXS1 protein(Q8NBZ7)(Ile51-Ser420), fused with C-terminal His tag, was expressed in E. coli. |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | C-His |
| Protein length : | Ile51-Ser420 |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 44 kDa |
| AASequence : | IESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | UXS1 UDP-glucuronate decarboxylase 1 [ Homo sapiens ] |
| Official Symbol | UXS1 |
| Synonyms | UGD; SDR6E1 |
| Gene ID | 80146 |
| mRNA Refseq | NM_025076.4 |
| Protein Refseq | NP_079352.2 |
| MIM | 609749 |
| UniProt ID | Q8NBZ7 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UXS1 Products
Required fields are marked with *
My Review for All UXS1 Products
Required fields are marked with *
0
Inquiry Basket
