Recombinant Full Length Human UXS1 Protein, GST tagged

• Cat.No.: UXS1-3639H
• Product Overview: Recombinant human UXS1 full-length ORF ( NP_079352.2, 1 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an enzyme found in the perinuclear Golgi which catalyzes the synthesis of UDP-xylose used in glycosaminoglycan (GAG) synthesis on proteoglycans. The GAG chains are covalently attached to proteoglycans which participate in signaling pathways during development. Multiple transcript variants encoding different isoforms have been found for this gene.
• Source: Wheat Germ (in vitro)
• Species: Human
• Tag: GST
• Molecular Mass: 74 kDa
• Protein length: Full Length
• AA Sequence: MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UXS1 UDP-glucuronate decarboxylase 1 [ Homo sapiens (human) ]
• Official Symbol: UXS1
• Synonyms: UXS1; UDP-glucuronate decarboxylase 1; UGD; hUXS; hUXS1; SDR6E1; UDP-glucuronic acid decarboxylase 1; UXS-1; short chain dehydrogenase/reductase family 6E, member 12; EC 4.1.1.35
• Gene ID: 80146
• mRNA Refseq: NM_025076
• Protein Refseq: NP_079352
• MIM: 609749
• UniProt ID: Q8NBX3