Recombinant Human URM1, His-tagged

• Cat.No.: URM1-31676TH
• Product Overview: Recombinant full length Human Urm1 with N terminal His tag; 121 amino acids with tag, MWt 13.5 kDa.

Specification

• Description: Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3.
• Protein length: 101 amino acids
• Conjugation: HIS
• Molecular Weight: 13.500kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG
• Sequence Similarities: Belongs to the URM1 family.

Gene Information

• Gene Name: URM1 ubiquitin related modifier 1 [ Homo sapiens ]
• Official Symbol: URM1
• Synonyms: URM1; ubiquitin related modifier 1; C9orf74, chromosome 9 open reading frame 74 , ubiquitin related modifier 1 homolog (S. cerevisiae); ubiquitin-related modifier 1 homolog; MGC2668
• Gene ID: 81605
• mRNA Refseq: NM_001135947
• Protein Refseq: NP_001129419
• MIM: 612693
• Uniprot ID: Q9BTM9
• Chromosome Location: 9q34.13
• Pathway: Sulfur relay system, organism-specific biosystem; Sulfur relay system, conserved biosystem
• Function: protein binding; contributes_to sulfurtransferase activity