Recombinant Human UQCR10 Protein (1-63 aa), GST-tagged

Cat.No. : UQCR10-2152H
Product Overview : Recombinant Human UQCR10 Protein (1-63 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-63 aa
Description : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.2 kDa
AA Sequence : AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name UQCR10 ubiquinol-cytochrome c reductase, complex III subunit X [ Homo sapiens (human) ]
Official Symbol UQCR10
Synonyms QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2;
Gene ID 29796
mRNA Refseq NM_001003684
Protein Refseq NP_001003684
UniProt ID Q9UDW1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UQCR10 Products

Required fields are marked with *

My Review for All UQCR10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon