Recombinant Human UQCR10 Protein (1-63 aa), GST-tagged

• Cat.No.: UQCR10-2152H
• Product Overview: Recombinant Human UQCR10 Protein (1-63 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length.

Specification

• Description: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.2 kDa
• Protein length: 1-63 aa
• AA Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: UQCR10 ubiquinol-cytochrome c reductase, complex III subunit X [ Homo sapiens (human) ]
• Official Symbol: UQCR10
• Synonyms: QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2
• Gene ID: 29796
• mRNA Refseq: NM_001003684
• Protein Refseq: NP_001003684
• UniProt ID: Q9UDW1