Recombinant Human UPP2 Protein, Full Length, N-GST tagged

• Cat.No.: UPP2-20HFL
• Product Overview: Human UPP2 full-length ORF ( NP_775491.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Description: Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.
• Source: Wheat Germ (in vitro)
• Species: Human
• Tag: GST
• Protein length: Full Length
• Molecular Mass: 61.9 kDa
• AA Sequence: MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UPP2 uridine phosphorylase 2 [ Homo sapiens (human) ]
• Official Symbol: UPP2
• Synonyms: UPP2; uridine phosphorylase 2; UDRPASE2; UP2; UPASE2; UPase 2; urdPase 2; uridine phosphorylase-2; liver-specific uridine phosphorylase
• Gene ID: 151531
• mRNA Refseq: NM_173355
• Protein Refseq: NP_775491
• MIM: 617340
• UniProt ID: O95045