Recombinant Human UNC13D, His-tagged

• Cat.No.: UNC13D-28544TH
• Product Overview: Recombinant fragment, corresponding to amino acids 861-1090 of Human Munc 13-4 with a N terminal His tag; 34 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 861-1090 a.a.
• Description: This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.
• Conjugation: HIS
• Tissue specificity: Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.
• Form: Lyophilised:Reconstitution with 146 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GCGLPPKALHTATFQALQRDLELQAASSRELIRKYFCSRI QQQAETTSEELGAVTVKASYRASEQKLRVELLSASSLL PLDSNGSSDPFVQLTLEPRHEFPELAARETQKHKKDLH PLFDETFEFLVPAEPCRKAGACLLLTVLDYDTLGADDLEG EAFLPLREVPGLSGSEEPGEVPQTRLPLTYPAPNGDPI LQLLEGRKGDREAQVFVRLRRHRAKQASQHALRPAP
• Sequence Similarities: Belongs to the unc-13 family.Contains 2 C2 domains.Contains 1 MHD1 (MUNC13 homology domain 1) domain.Contains 1 MHD2 (MUNC13 homology domain 2) domain.

Gene Information

• Gene Name: UNC13D unc-13 homolog D (C. elegans) [ Homo sapiens ]
• Official Symbol: UNC13D
• Synonyms: UNC13D; unc-13 homolog D (C. elegans); protein unc-13 homolog D; Munc13 4
• Gene ID: 201294
• mRNA Refseq: NM_199242
• Protein Refseq: NP_954712
• MIM: 608897
• Uniprot ID: Q70J99
• Chromosome Location: 17q25.3
• Function: protein binding