Recombinant Human UGT1A3
Cat.No. : | UGT1A3-207H |
Product Overview : | Recombinant Human UGT1A3, fused without tag, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. Substrates of this enzyme include estrone, 2-hydroxyestrone, and metabolites of benzo alpha-pyrene. |
Form : | Liquid |
Molecular Mass : | 58.8 kDa |
AA Sequence : | MATGLQVPLPWLATGLLLLLSVQPWAESGKVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFF TLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCVELLHNEALIRHLNATSFDVVL TDPVNLCAAVLAKYLSIPTVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFMQRVKNMLYPLALSYICH AFSAPYASLASELFQREVSVVDILSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANRKPLSQEFEAYINASGE HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAG SHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKD RPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRV KKAHKSKTH |
Applications : | Antibody Production; Functional Study; Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 [ Homo sapiens (human) ] |
Official Symbol | UGT1A3 |
Synonyms | UDP glucuronosyltransferase 1 family, polypeptide A3; UDPGT 1-3; UGT1C; EC 2.4.1.17; UDP glycosyltransferase 1 family, polypeptide A3; OTTHUMP00000065199; UGT-1C; UDPGT; UGT1*3; UDP glucuronosyltransferase 1A3; UGT1-03; UDP-glucuronosyltransferase 1-3; UGT1.3; GNT1; UDP-glucuronosyltransferase 1-C; UGT1; UDP-glucuronosyltransferase 1A3; OTTHUMP00000065193 |
Gene ID | 54659 |
mRNA Refseq | NM_019093 |
Protein Refseq | NP_061966 |
MIM | 606428 |
UniProt ID | Q5DT01 |
Chromosome Location | 2q37 |
Pathway | Ascorbate and aldarate metabolism; Drug metabolism - cytochrome P450; Metabolic pathways |
Function | enzyme binding; glucuronosyltransferase activity; protein heterodimerization activity |
◆ Recombinant Proteins | ||
UGT1A3-207H | Recombinant Human UGT1A3 | +Inquiry |
RFL8549HF | Recombinant Full Length Human Udp-Glucuronosyltransferase 1-3(Ugt1A3) Protein, His-Tagged | +Inquiry |
UGT1A3-539HF | Recombinant Full Length Human UGT1A3 Protein | +Inquiry |
UGT1A3-512H | Recombinant Human UGT1A3 Protein, MYC/DDK-tagged | +Inquiry |
UGT1A3-98H | Active Recombinant Human UGT1A3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT1A3 Products
Required fields are marked with *
My Review for All UGT1A3 Products
Required fields are marked with *
0
Inquiry Basket