Recombinant Human UFC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UFC1-4367H
• Product Overview: UFC1 MS Standard C13 and N15-labeled recombinant protein (NP_057490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1).
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.3 kDa
• AA Sequence: MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITCPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UFC1 ubiquitin-fold modifier conjugating enzyme 1 [ Homo sapiens (human) ]
• Official Symbol: UFC1
• Synonyms: UFC1; ubiquitin-fold modifier conjugating enzyme 1; ubiquitin-fold modifier-conjugating enzyme 1; HSPC155; Ufm1-conjugating enzyme 1
• Gene ID: 51506
• mRNA Refseq: NM_016406
• Protein Refseq: NP_057490
• MIM: 610554
• UniProt ID: Q9Y3C8