Recombinant Human UFC1, His-tagged

• Cat.No.: UFC1-30871TH
• Product Overview: Recombinant full length Human UFC1 with an N terminal His tag; 187 amino acids, predicted MWt 21.6kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 167 amino acids
• Description: UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1; MIM 610553) (Komatsu et al.
• Conjugation: HIS
• Molecular Weight: 21.600kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
• Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family. UFC1 subfamily.

Gene Information

• Gene Name: UFC1 ubiquitin-fold modifier conjugating enzyme 1 [ Homo sapiens ]
• Official Symbol: UFC1
• Synonyms: UFC1; ubiquitin-fold modifier conjugating enzyme 1; ubiquitin-fold modifier-conjugating enzyme 1; HSPC155
• Gene ID: 51506
• mRNA Refseq: NM_016406
• Protein Refseq: NP_057490
• MIM: 610554
• Uniprot ID: Q9Y3C8
• Chromosome Location: 1q23.3
• Function: UFM1 conjugating enzyme activity; protein binding