Recombinant Human UCMA protein

Description :	C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
Source :	E. coli
Species :	Human
Form :	Supplied as a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
AA Sequence :	GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDG LHPSYLYNRHHT
Endotoxin :	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity :	Greater than 95% as determined by reducing SDS-PAGE.
Storage :	Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Tag :	Non
Protein length :	65-138 a.a.

Gene Name	UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ]
Official Symbol	UCMA
Synonyms	UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49;
Gene ID	221044
mRNA Refseq	NM_145314
Protein Refseq	NP_660357
UniProt ID	Q8WVF2
Chromosome Location	10p13