Recombinant Human UCMA Protein, GST-tagged

• Cat.No.: UCMA-434H
• Product Overview: Human C10orf49 full-length ORF (AAH18068.2, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 41.58 kDa
• AA Sequence: MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ]
• Official Symbol: UCMA
• Synonyms: UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49
• Gene ID: 221044
• mRNA Refseq: NM_145314
• Protein Refseq: NP_660357
• UniProt ID: Q8WVF2