Recombinant Human UBXN11 protein, His-tagged

• Cat.No.: UBXN11-2552H
• Product Overview: Recombinant Human UBXN11 protein(1-324 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-324 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVISCSSNHTFGDFEGSGDTQPPQTPPILRGSRCTPWGTPV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: UBXN11 UBX domain protein 11 [ Homo sapiens ]
• Official Symbol: UBXN11
• Synonyms: UBXN11; UBX domain protein 11; UBX domain containing 5 , UBXD5; UBX domain-containing protein 11; SOC; SOCI; socius; UBX domain-containing protein 5; colorectal tumor-associated antigen-1; colorectal tumor-associated antigen COA-1; COA-1; UBXD5; PP2243; DKFZp686F04228
• Gene ID: 91544
• mRNA Refseq: NM_001077262
• Protein Refseq: NP_001070730
• MIM: 609151
• UniProt ID: Q5T124