Recombinant Human UBXN11, His-tagged

• Cat.No.: UBXN11-31555TH
• Product Overview: Recombinant fragment, corresponding to amino acids 191-400 of Human UBXD5 isoform 3 with N terminal His tag; 210 amino acids, 28kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 191-400 a.a.
• Description: This gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrimeric G proteins through their G-alpha subunits and promotes Rho GTPase activation. It is proposed to serve a bidirectional role in the promotion and inhibition of Rho activity through upstream signaling pathways. The 3 coding sequence of this gene contains a polymoprhic region of 24 nt tandem repeats. Several transcripts containing between 1.5 and five repeat units have been reported. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 99 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDI RGPIRDTLQNCCPLPARIQEIVVETPTLAAERERSQES PNTPAPPLSMLRIKSENGEQAFLLMMQPDNTIGDVRAL LAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPK AALLLRARRAPKSSLKFSPGPCPGPGPGPSPGPGPGPS PGPGPGPSPCPGPSPSPQ

Gene Information

• Gene Name: UBXN11 UBX domain protein 11 [ Homo sapiens ]
• Official Symbol: UBXN11
• Synonyms: UBXN11; UBX domain protein 11; UBX domain containing 5 , UBXD5; UBX domain-containing protein 11; SOC; SOCI; socius
• Gene ID: 91544
• mRNA Refseq: NM_183008
• Protein Refseq: NP_892120
• MIM: 609151
• Uniprot ID: Q5T124
• Chromosome Location: 1p36.11