Recombinant Human UBN1 protein, GST-tagged

• Cat.No.: UBN1-301479H
• Product Overview: Recombinant Human UBN1 (592-791 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met592-His791
• AA Sequence: MAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTGGLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEAVSKELAALNSRAAGNSEFTLPAPSKAPAEKVGGVLCTEEKRNFAKPSPSAPPPASSLQSPLNFLAEQALALGQSSQEKKPESSGYKELSCQAPLNKGLPEVHQSKAKHHSLPRTSH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: UBN1 ubinuclein 1 [ Homo sapiens ]
• Official Symbol: UBN1
• Synonyms: UBN1; ubinuclein 1; ubinuclein-1; HIRA-binding protein; ubiquitously expressed nuclear protein; VT; VT4
• Gene ID: 29855
• mRNA Refseq: NM_001079514
• Protein Refseq: NP_001072982
• MIM: 609771
• UniProt ID: Q9NPG3