Recombinant Human Ubiquitin-Conjugating Enzyme E2M, His-tagged
Cat.No. : | UBE2M-1501H |
Product Overview : | Ubiquitin Conjugating Enzyme E2M Human Recombinant produced in E.coli is a 25 kDa protein containing 216 amino acids. The UBE2M protein contains 6xHis tag and is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Tag : | His |
Description : | UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF (?-TRCP) complex which is important as the E3-ligase in the ubiquitinylation of I?B?. NEDDylation of Cul-1 is essential for conjugation and processing of NF-?B p105 by SCF (?-TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12. |
Form : | Lyophilized from a 0.2 μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1 mM DTT, pH 7.5. |
Purity : | Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Physical Appearance : | Sterile Filtered white lyophilized powder. |
Solubility : | It is recommended to reconstitute the lyophilized UBE2M in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
Amino acid sequence : | MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEE SAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVIC PDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLN ILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQ RSMRGGYIGSTYFERCLK |
Storage : | Lyophilized UBE2M although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2M should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | UBE2M ubiquitin-conjugating enzyme E2M [ Homo sapiens ] |
Official Symbol | UBE2M |
Synonyms | UBE2M; ubiquitin-conjugating enzyme E2M; UBC12; hUbc12; UBC-RS2; NEDD8-conjugating enzyme Ubc12 yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast) |
Gene ID | 9040 |
mRNA Refseq | NM_003969 |
Protein Refseq | NP_003960 |
MIM | 603173 |
UniProt ID | P61081 |
Chromosome Location | 19q13.43 |
Pathway | Adaptive Immunity Signaling; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation; Immune System; Ubiquitin mediated proteolysis |
Function | ATP binding; NEDD8 ligase activity; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; ribosomal S6-glutamic acid ligase activity; ubiquitin-protein ligase activity |
◆ Recombinant Proteins | ||
UBE2M-05H | Recombinant Human Ubiquitin Conjugating Enzyme 12, His6-Tagged | +Inquiry |
UBE2M-6849H | Recombinant Human Ubiquitin-Conjugating Enzyme E2M, His-tagged | +Inquiry |
UBE2M-001H | Recombinant Human UBE2M protein | +Inquiry |
UBE2M-135H | Recombinant Human UBE2M, His-tagged | +Inquiry |
UBE2M-4878R | Recombinant Rhesus Macaque UBE2M Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2M-567HCL | Recombinant Human UBE2M 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2M Products
Required fields are marked with *
My Review for All UBE2M Products
Required fields are marked with *
0
Inquiry Basket