Recombinant Human Ubiquitin-Conjugating Enzyme E2M, His-tagged

• Cat.No.: UBE2M-1501H
• Product Overview: Ubiquitin Conjugating Enzyme E2M Human Recombinant produced in E.coli is a 25 kDa protein containing 216 amino acids. The UBE2M protein contains 6xHis tag and is purified by proprietary chromatographic techniques.

Specification

• Cat. No.: UBE2M-1501H
• Description: UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF (?-TRCP) complex which is important as the E3-ligase in the ubiquitinylation of I?B?. NEDDylation of Cul-1 is essential for conjugation and processing of NF-?B p105 by SCF (?-TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12.
• Source: Human
• Host: Escherichia Coli.
• Form: Lyophilized from a 0.2 μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1 mM DTT, pH 7.5.
• Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Physical Appearance: Sterile Filtered white lyophilized powder.
• Solubility: It is recommended to reconstitute the lyophilized UBE2M in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
• Amino acid sequence: MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEE SAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVIC PDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLN ILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQ RSMRGGYIGSTYFERCLK
• Storage: Lyophilized UBE2M although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2M should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Gene Information

• Gene Name: UBE2M ubiquitin-conjugating enzyme E2M [ Homo sapiens ]
• Official Symbol: UBE2M
• Synonyms: UBE2M; ubiquitin-conjugating enzyme E2M; UBC12; hUbc12; UBC-RS2; NEDD8-conjugating enzyme Ubc12 yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
• Gene ID: 9040
• mRNA Refseq: NM_003969
• Protein Refseq: NP_003960
• MIM: 603173
• UniProt ID: P61081
• Chromosome Location: 19q13.43
• Pathway: Adaptive Immunity Signaling; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation; Immune System; Ubiquitin mediated proteolysis
• Function: ATP binding; NEDD8 ligase activity; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; ribosomal S6-glutamic acid ligase activity; ubiquitin-protein ligase activity