Recombinant Human UBE2L3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UBE2L3-4247H
• Product Overview: UBE2L3 MS Standard C13 and N15-labeled recombinant protein (NP_003338) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 17.9 kDa
• AA Sequence: MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UBE2L3 ubiquitin-conjugating enzyme E2L 3 [ Homo sapiens (human) ]
• Official Symbol: UBE2L3
• Synonyms: UBE2L3; ubiquitin-conjugating enzyme E2L 3; ubiquitin-conjugating enzyme E2 L3; UBCH7; ubiquitin-protein ligase L3; ubiquitin carrier protein L3; ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme UBCH7; E2-F1; L-UBC; UbcM4
• Gene ID: 7332
• mRNA Refseq: NM_003347
• Protein Refseq: NP_003338
• MIM: 603721
• UniProt ID: P68036