Recombinant Human UBE2D3 protein

Cat.No. : UBE2D3-2487H
Product Overview : Recombinant Human UBE2D3 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Ubiquitin-conjugating enzyme E2 D3 belongs to the ubiquitin-conjugating enzyme family and is encoded by the UBE2D3 gene in humans. The ubiquitin-conjugating enzymes, also known as E2 enzymes and more rarely as ubiquitin-carrier enzymes, take part in the second step in the ubiquitination reaction. In this reaction, E1 activates the ubiquitin by covalently attaching the molecule to its active site cysteine residue. The activated ubiquitin is then transferred to an E2 cysteine and then the E2 molecule binds E3 via a structurally conserved binding region. The ubiquitination reaction can modify proteins and regulate protein degradation. The UBE2D3 is a human homolog of the yeast UBC4/5 family and play many important regulatory roles in inflammation and cancer. It mediates the degradation of a myriad of short-lived regulatory proteins (such as p53 in the presence of E6/E6-AP or MDM2, c-Fos, IκBα, p105) and abnormal proteins and has 88% and 89% sequence identity with UbcH5a and UbcH5b respectively.
Source : E.coli
Species : Human
Form : 0.2μm Filtered concentrated solution in 50 mM HEPES, pH 6.5, with 125 mM NaCl, 10 % Glycerol, 5 % Trehalose, 1 mM DTT.
Molecular Mass : Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 147 amino acids (a.a.) of human UBE2D3/UBC5C and 8 a.a. vector sequence including 6 × His tag at N-terminus.
Protein length : 155
AA Sequence : MHHHHHHAMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Endotoxin : Less than 1 EU/µg of rHuUBE2D3/UBC5C, His as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Tag : Non
Gene Name UBE2D3
Official Symbol UBE2D3
Synonyms UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; E2(17)KB 3; ubiquitin-protein ligase D3; ubiquitin carrier protein D3; ubiquitin-conjugating enzyme E2(17)KB 3; ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); UBC4/5; UBCH5C; E2(17)KB3; MGC5416; MGC43926;
Gene ID 7323
mRNA Refseq NM_003340
Protein Refseq NP_003331
MIM 602963
UniProt ID P61077

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UBE2D3 Products

Required fields are marked with *

My Review for All UBE2D3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon