Recombinant Human U2AF2 Protein (141 a.a.-240 a.a.), N-GST-tagged

• Cat.No.: U2AF2-13H
• Product Overview: Human U2AF2 partial ORF ( NP_001012496.1, 141 a.a.-240 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 141-240
• Description: U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date.
• Molecular Mass: 36.74 kDa
• AA Sequence: GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: U2AF2 U2 small nuclear RNA auxiliary factor 2 [ Homo sapiens (human) ]
• Official Symbol: U2AF2
• Synonyms: U2AF2; U2 small nuclear RNA auxiliary factor 2; U2AF65; splicing factor U2AF 65 kDa subunit; U2 (RNU2) small nuclear RNA auxiliary factor 2; U2 auxiliary factor 65 kDa subunit; U2 small nuclear ribonucleoprotein auxiliary factor (65kD); U2 snRNP auxiliary factor large subunit; hU2AF65
• Gene ID: 11338
• mRNA Refseq: NM_001012478
• Protein Refseq: NP_001012496
• MIM: 191318
• UniProt ID: P26368