Recombinant Human TXNDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TXNDC12-6147H
Product Overview : TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants.
Molecular Mass : 19.2 kDa
AA Sequence : METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TXNDC12 thioredoxin domain containing 12 [ Homo sapiens (human) ]
Official Symbol TXNDC12
Synonyms TXNDC12; thioredoxin domain containing 12 (endoplasmic reticulum); thioredoxin domain-containing protein 12; AGR1; anterior gradient homolog 1 (Xenopus laevis); endoplasmic reticulum thioredoxin superfamily member; 18 kDa; ERP18; ERP19; hAG 1; PDIA16; protein disulfide isomerase family A; member 16; TLP19; ER protein 18; ER protein 19; anterior gradient homolog 1; thioredoxin-like protein p19; endoplasmic reticulum protein ERp19; endoplasmic reticulum resident protein 18; endoplasmic reticulum resident protein 19; protein disulfide isomerase family A, member 16; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; AG1; ERP16; hAG-1; hTLP19;
Gene ID 51060
mRNA Refseq NM_015913
Protein Refseq NP_056997
MIM 609448
UniProt ID O95881

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TXNDC12 Products

Required fields are marked with *

My Review for All TXNDC12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon