Recombinant Human TXNDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TXNDC12-6147H |
Product Overview : | TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants. |
Molecular Mass : | 19.2 kDa |
AA Sequence : | METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TXNDC12 thioredoxin domain containing 12 [ Homo sapiens (human) ] |
Official Symbol | TXNDC12 |
Synonyms | TXNDC12; thioredoxin domain containing 12 (endoplasmic reticulum); thioredoxin domain-containing protein 12; AGR1; anterior gradient homolog 1 (Xenopus laevis); endoplasmic reticulum thioredoxin superfamily member; 18 kDa; ERP18; ERP19; hAG 1; PDIA16; protein disulfide isomerase family A; member 16; TLP19; ER protein 18; ER protein 19; anterior gradient homolog 1; thioredoxin-like protein p19; endoplasmic reticulum protein ERp19; endoplasmic reticulum resident protein 18; endoplasmic reticulum resident protein 19; protein disulfide isomerase family A, member 16; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; AG1; ERP16; hAG-1; hTLP19; |
Gene ID | 51060 |
mRNA Refseq | NM_015913 |
Protein Refseq | NP_056997 |
MIM | 609448 |
UniProt ID | O95881 |
◆ Recombinant Proteins | ||
TXNDC12-4850R | Recombinant Rhesus Macaque TXNDC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
TXNDC12-1870M | Recombinant Mouse TXNDC12 Protein (25-170 aa), His-tagged | +Inquiry |
TXNDC12-1925M | Recombinant Mouse TXNDC12 Protein (25-170 aa), His-tagged | +Inquiry |
TXNDC12-5037R | Recombinant Rhesus monkey TXNDC12 Protein, His-tagged | +Inquiry |
TXNDC12-6373R | Recombinant Rat TXNDC12 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNDC12-626HCL | Recombinant Human TXNDC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TXNDC12 Products
Required fields are marked with *
My Review for All TXNDC12 Products
Required fields are marked with *
0
Inquiry Basket