Recombinant Human TXNDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TXNDC12-6147H
• Product Overview: TXNDC12 MS Standard C13 and N15-labeled recombinant protein (NP_056997) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.2 kDa
• AA Sequence: METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKHEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TXNDC12 thioredoxin domain containing 12 [ Homo sapiens (human) ]
• Official Symbol: TXNDC12
• Synonyms: TXNDC12; thioredoxin domain containing 12 (endoplasmic reticulum); thioredoxin domain-containing protein 12; AGR1; anterior gradient homolog 1 (Xenopus laevis); endoplasmic reticulum thioredoxin superfamily member; 18 kDa; ERP18; ERP19; hAG 1; PDIA16; protein disulfide isomerase family A; member 16; TLP19; ER protein 18; ER protein 19; anterior gradient homolog 1; thioredoxin-like protein p19; endoplasmic reticulum protein ERp19; endoplasmic reticulum resident protein 18; endoplasmic reticulum resident protein 19; protein disulfide isomerase family A, member 16; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; AG1; ERP16; hAG-1; hTLP19
• Gene ID: 51060
• mRNA Refseq: NM_015913
• Protein Refseq: NP_056997
• MIM: 609448
• UniProt ID: O95881