Recombinant Human TXNDC12 protein, His-SUMO-tagged

• Cat.No.: TXNDC12-3638H
• Product Overview: Recombinant Human TXNDC12 protein(O95881)(27-172aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.4 kDa
• Protein length: 27-172aa
• AA Sequence: HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum) [ Homo sapiens ]
• Official Symbol: TXNDC12
• Synonyms: TXNDC12; thioredoxin domain containing 12 (endoplasmic reticulum); thioredoxin domain-containing protein 12; AGR1; anterior gradient homolog 1 (Xenopus laevis); endoplasmic reticulum thioredoxin superfamily member; 18 kDa; ERP18; ERP19; hAG 1; PDIA16; protein disulfide isomerase family A; member 16; TLP19; ER protein 18; ER protein 19; anterior gradient homolog 1; thioredoxin-like protein p19; endoplasmic reticulum protein ERp19; endoplasmic reticulum resident protein 18; endoplasmic reticulum resident protein 19; protein disulfide isomerase family A, member 16; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; AG1; ERP16; hAG-1; hTLP19
• Gene ID: 51060
• mRNA Refseq: NM_015913
• Protein Refseq: NP_056997
• MIM: 609448
• UniProt ID: O95881