Recombinant Human TXLNGY Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TXLNGY-4455H
• Product Overview: CYorf15A MS Standard C13 and N15-labeled recombinant protein (NP_001005852) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TXLNGY (Taxilin Gamma Pseudogene, Y-Linked) is a Pseudogene. Gene Ontology (GO) annotations related to this gene include syntaxin binding.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.7 kDa
• AA Sequence: MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRRELPEQEVAPPSGQQALQCNRNKEKVLERQGLSLSPRLERGGTFMGHGSLKLPELVILSLQTLETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TXLNGY taxilin gamma pseudogene, Y-linked [ Homo sapiens (human) ]
• Official Symbol: TXLNGY
• Synonyms: TXLNGY; taxilin gamma pseudogene, Y-linked; TXLNG2P; CYorf15A; CYorf15B; lipopolysaccaride-specific response 5-like protein; taxilin gamma 2, pseudogene; FLJ33216; MGC21662; MGC131732; DKFZp451G0616
• Gene ID: 246126
• mRNA Refseq: NM_001005852
• Protein Refseq: NP_001005852
• MIM: 400031