Recombinant Human TXLNGY Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TXLNGY-4455H |
Product Overview : | CYorf15A MS Standard C13 and N15-labeled recombinant protein (NP_001005852) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TXLNGY (Taxilin Gamma Pseudogene, Y-Linked) is a Pseudogene. Gene Ontology (GO) annotations related to this gene include syntaxin binding. |
Molecular Mass : | 14.7 kDa |
AA Sequence : | MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRRELPEQEVAPPSGQQALQCNRNKEKVLERQGLSLSPRLERGGTFMGHGSLKLPELVILSLQTLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TXLNGY taxilin gamma pseudogene, Y-linked [ Homo sapiens (human) ] |
Official Symbol | TXLNGY |
Synonyms | TXLNGY; taxilin gamma pseudogene, Y-linked; TXLNG2P; CYorf15A; CYorf15B; lipopolysaccaride-specific response 5-like protein; taxilin gamma 2, pseudogene; FLJ33216; MGC21662; MGC131732; DKFZp451G0616 |
Gene ID | 246126 |
mRNA Refseq | NM_001005852 |
Protein Refseq | NP_001005852 |
MIM | 400031 |
◆ Recombinant Proteins | ||
TXLNGY-3877HF | Recombinant Full Length Human TXLNGY Protein, GST-tagged | +Inquiry |
TXLNGY-4455H | Recombinant Human TXLNGY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TXLNGY-5193H | Recombinant Human TXLNGY Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TXLNGY Products
Required fields are marked with *
My Review for All TXLNGY Products
Required fields are marked with *
0
Inquiry Basket