Recombinant Human TXLNGY Protein, GST-tagged

• Cat.No.: TXLNGY-5193H
• Product Overview: Human CYorf15B full-length ORF ( AAH35312.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: TXLNGY (Taxilin Gamma Pseudogene, Y-Linked) is a Pseudogene. GO annotations related to this gene include syntaxin binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.9 kDa
• AA Sequence: MNSHSSSFFFASFICRSVLLTYIILDNKEEHMQQKKEEEEVLKEVTAHFQITLTETQAQLEQHEIHNAKLQQENMEMGEKLKKLTDQYALREEVNGVWFVYRQLLTSSKSYTLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TXLNGY taxilin gamma pseudogene, Y-linked [ Homo sapiens (human) ]
• Official Symbol: TXLNGY
• Synonyms: CYorf15B; TXLNGY; taxilin gamma pseudogene, Y-linked; TXLNG2P; CYorf15A
• Gene ID: 246126
• MIM: 400031
• UniProt ID: Q9BZA5