Recombinant Human TUSC1, His-tagged

Cat.No. : TUSC1-31634TH
Product Overview : Recombinant fragment, corresponding to amino acids 59-212 of Human TUSC1 with N terminal His tag; Predicted MWt 19 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 59-212 a.a.
Description : This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 118 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QQLEERFADLAASHLEAIRARDEWDRQNARLRQENARLRL ENRRLKRENRSLFRQALRLPGEGGNGTPAEARRVPEEA STNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQ LHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPSGPWL
Gene Name TUSC1 tumor suppressor candidate 1 [ Homo sapiens ]
Official Symbol TUSC1
Synonyms TUSC1; tumor suppressor candidate 1; tumor suppressor candidate gene 1 protein; TSG 9;
Gene ID 286319
mRNA Refseq NM_001004125
Protein Refseq NP_001004125
MIM 610529
Uniprot ID Q2TAM9
Chromosome Location 9p21.2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TUSC1 Products

Required fields are marked with *

My Review for All TUSC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon