Recombinant Human TUBB3 protein, His-tagged
Cat.No. : | TUBB3-005H |
Product Overview : | Recombinant Human TUBB3 protein(44-259 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 44-259 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP |
Gene Name | TUBB3 tubulin, beta 3 class III [ Homo sapiens ] |
Official Symbol | TUBB3 |
Synonyms | TUBB3; tubulin, beta 3 class III; tubulin, beta 3; tubulin beta-3 chain; beta 4; class III beta tubulin; tubulin beta-III; tubulin beta-4 chain; class III beta-tubulin; CDCBM; TUBB4; beta-4; CFEOM3A; |
Gene ID | 10381 |
mRNA Refseq | NM_001197181 |
Protein Refseq | NP_001184110 |
MIM | 602661 |
UniProt ID | Q13509 |
◆ Recombinant Proteins | ||
TUBB3-5204H | Recombinant Human TUBB3 protein, GST-tagged | +Inquiry |
TUBB3-6019R | Recombinant Rat TUBB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB3-6744H | Recombinant Human TUBB3 protein, GST-tagged | +Inquiry |
TUBB3-7552H | Recombinant Human TUBB3, His-tagged | +Inquiry |
TUBB3-17618M | Recombinant Mouse TUBB3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB3-648HCL | Recombinant Human TUBB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBB3 Products
Required fields are marked with *
My Review for All TUBB3 Products
Required fields are marked with *
0
Inquiry Basket