Recombinant Human TUBA1A, GST-tagged
Cat.No. : | TUBA1A-107H |
Product Overview : | Recombinant Human TUBA1A (1 a.a. - 451 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulins. The genes encoding these microtubule constituents belong to the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes, which are highly conserved among species. This gene encodes alpha tubulin and is highly similar to the mouse and rat Tuba1 genes. Northern blotting studies have shown that the gene expression is predominantly found in morphologically differentiated neurologic cells. This gene is one of three alpha-tubulin genes in a cluster on chromosome 12q. Mutations in this gene cause lissencephaly type 3 (LIS3) - a neurological condition characterized by microcephaly, mental retardation, and early-onset epilepsy and caused by defective neuronal migration. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Mass : | 75.24 kDa |
AA Sequence : | MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVI DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYT NLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE Y |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TUBA1A tubulin, alpha 1a [ Homo sapiens (human) ] |
Official Symbol | TUBA1A |
Synonyms | TUBA1A; LIS3; TUBA3; B-ALPHA-1; tubulin, alpha 1a; tubulin alpha-1A chain; hum-a-tub1; hum-a-tub2; tubulin B-alpha-1; tubulin alpha-3 chain; tubulin, alpha, brain-specific |
Gene ID | 7846 |
mRNA Refseq | NM_006009 |
Protein Refseq | NP_006000 |
MIM | 602529 |
UniProt ID | Q71U36 |
Chromosome Location | 12q13.12 |
Pathway | Chaperonin-mediated protein folding; Formation of tubulin folding intermediates by CCT/TriC; Metabolism of proteins |
Function | GTP binding; GTPase activity; structural constituent of cytoskeleton |
◆ Recombinant Proteins | ||
TUBA1A-16H | Recombinant Human TUBA1A protein, MYC/DDK-tagged | +Inquiry |
TUBA1A-17608M | Recombinant Mouse TUBA1A Protein | +Inquiry |
TUBA1A-106H | Recombinant Human TUBA1A, GST-tagged | +Inquiry |
TUBA1A-17H | Recombinant Human TUBA1A protein, GST-tagged | +Inquiry |
TUBA1A-107H | Recombinant Human TUBA1A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA1A-662HCL | Recombinant Human TUBA1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBA1A Products
Required fields are marked with *
My Review for All TUBA1A Products
Required fields are marked with *
0
Inquiry Basket