Recombinant Human TTN Protein, His-tagged
Cat.No. : | TTN-1391H |
Product Overview : | Recombinant Human TTN Protein (5398-5604aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 5398-5604 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGF LTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLV RGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | TTN titin [ Homo sapiens] |
Official Symbol | TTN |
Synonyms | TTN; titin; TMD;CMH9; CMD1G; CMPD4; EOMFC; FLJ32040; FLJ26020; FLJ26409; FLJ34413; FLJ39564;FLJ43066; HMERF; MYLK5; LGMD2J; MPRM; DKFZp451N061; connectin; OTTHUMP00000233809;OTTHUMP00000233810; rhabdomyosarcoma antigen MU-RMS-40.14; cardiomyopathy,dilated 1G (autosomal dominant); EC 2.7.11.1 |
Gene ID | 7273 |
mRNA Refseq | NM_003319 |
Protein Refseq | NP_003310 |
MIM | 188840 |
UniProt ID | E9PPD3 |
◆ Recombinant Proteins | ||
TTN-301647H | Recombinant Human TTN protein, GST-tagged | +Inquiry |
TTN-25H | Recombinant Human TTN, GST-tagged | +Inquiry |
TTN-26H | Recombinant Human TTN, GST-tagged | +Inquiry |
TTN-1780H | Recombinant Human TTN protein, His-tagged | +Inquiry |
TTN-1391H | Recombinant Human TTN Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTN Products
Required fields are marked with *
My Review for All TTN Products
Required fields are marked with *
0
Inquiry Basket