Recombinant Human TTN protein, His&Myc-tagged

• Cat.No.: TTN-3629H
• Product Overview: Recombinant Human TTN protein(Q8WZ42)(14257-14543aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 14257-14543aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.9 kDa
• AA Sequence: RCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TTN titin [ Homo sapiens ]
• Official Symbol: TTN
• Synonyms: TTN; titin; cardiomyopathy, dilated 1G (autosomal dominant) , CMD1G; CMH9; CMPD4; FLJ32040; LGMD2J; MYLK5; TMD; connectin; rhabdomyosarcoma antigen MU-RMS-40.14; CMD1G; EOMFC; HMERF; FLJ26020; FLJ26409; FLJ34413; FLJ39564; FLJ43066; DKFZp451N061
• Gene ID: 7273
• mRNA Refseq: NM_001256850
• Protein Refseq: NP_001243779
• MIM: 188840
• UniProt ID: Q8WZ42