Recombinant Human TSLP Protein, His-tagged

• Cat.No.: TSLP-1390H
• Product Overview: Recombinant Human TSLP Protein (29-159aa) was expressed in Mammalian cells with N-terminal His tag.

Specification

• Source: Mammalian cells
• Species: Human
• Tag: His
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 18.9 kDa
• AA Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMF
  AMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 29-159 a.a.

Gene Information

• Gene Name: TSLP thymic stromal lymphopoietin [ Homo sapiens ]
• Official Symbol: TSLP
• Synonyms: TSLP; thymic stromal lymphopoietin
• Gene ID: 85480
• mRNA Refseq: NM_033035
• Protein Refseq: NP_149024
• MIM: 607003
• UniProt ID: Q969D9