Recombinant Human TSHR protein(311-380 aa), C-His-tagged

• Cat.No.: TSHR-2669H
• Product Overview: Recombinant Human TSHR protein(P16473)(311-380 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 311-380 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: QRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETLQA
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TSHR thyroid stimulating hormone receptor [ Homo sapiens ]
• Official Symbol: TSHR
• Synonyms: TSHR; thyroid stimulating hormone receptor; thyrotropin receptor; LGR3; TSH-R; thyrotropin receptor-I, hTSHR-I; seven transmembrane helix receptor; thyroid-stimulating hormone receptor; thyroid stimulating hormone receptor, isoform 2; CHNG1; hTSHR-I; MGC75129
• Gene ID: 7253
• mRNA Refseq: NM_000369
• Protein Refseq: NP_000360
• UniProt ID: P16473