Recombinant Human TRPV1 protein, His-GST-tagged

Cat.No. : TRPV1-8632H
Product Overview : Recombinant Human TRPV1 protein(Q8NER1)(1-155aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 1-155aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 48.4 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETG
Gene Name TRPV1 transient receptor potential cation channel, subfamily V, member 1 [ Homo sapiens ]
Official Symbol TRPV1
Synonyms TRPV1; transient receptor potential cation channel, subfamily V, member 1; vanilloid receptor subtype 1 , VR1; transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b; VR1; DKFZp434K0220;
Gene ID 7442
mRNA Refseq NM_018727
Protein Refseq NP_061197
MIM 602076
UniProt ID Q8NER1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRPV1 Products

Required fields are marked with *

My Review for All TRPV1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon