Recombinant Human TRPS1 protein, GST-tagged

• Cat.No.: TRPS1-301463H
• Product Overview: Recombinant Human TRPS1 (1158-1281 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Ser1158-Glu1281
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TRPS1 trichorhinophalangeal syndrome I [ Homo sapiens ]
• Official Symbol: TRPS1
• Synonyms: TRPS1; trichorhinophalangeal syndrome I; zinc finger transcription factor Trps1; LGCR; zinc finger protein GC79; tricho-rhino-phalangeal syndrome type I protein; GC79; MGC134928
• Gene ID: 7227
• mRNA Refseq: NM_014112
• Protein Refseq: NP_054831
• MIM: 604386
• UniProt ID: Q9UHF7