Recombinant Human TRPC2 protein, His-tagged
Cat.No. : | TRPC2-2811H |
Product Overview : | Recombinant Human TRPC2 protein(41-133 aa), fused to His tag, was expressed in E. coli. |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 41-133 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDAMLAAFQLSRELRRLARKEPEFKPEYIALESLSQDYGFQLLGMCWNQSEVTAVLNDLAEDSETEPEAEGLGLAFEEGIPSLVRPRLAVNYNQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
◆ Recombinant Proteins | ||
FAM108A1-12654H | Recombinant Human FAM108A1, His-tagged | +Inquiry |
TPP41-279T | Recombinant Treponema pallidum TPP41 protein, GST-tagged | +Inquiry |
ENDOU2-2748Z | Recombinant Zebrafish ENDOU2 | +Inquiry |
Cpa4-2282M | Recombinant Mouse Cpa4 Protein, Myc/DDK-tagged | +Inquiry |
CRFB17-7201Z | Recombinant Zebrafish CRFB17 | +Inquiry |
◆ Native Proteins | ||
HSV2Ag-355H | Active Native Herpes Simplex Virus 2 Protein | +Inquiry |
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOPC-5831HCL | Recombinant Human GOPC 293 Cell Lysate | +Inquiry |
SLC28A1-1746HCL | Recombinant Human SLC28A1 293 Cell Lysate | +Inquiry |
TMEM54-1795HCL | Recombinant Human TMEM54 cell lysate | +Inquiry |
RXRG-2097HCL | Recombinant Human RXRG 293 Cell Lysate | +Inquiry |
GUCA1A-002HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TRPC2 Products
Required fields are marked with *
My Review for All TRPC2 Products
Required fields are marked with *
0
Inquiry Basket