Recombinant Full Length Bovine Short Transient Receptor Potential Channel 2 Homolog(Trpc2) Protein, His-Tagged
Cat.No. : | RFL15808BF |
Product Overview : | Recombinant Full Length Bovine Short transient receptor potential channel 2 homolog(TRPC2) Protein (O62826) (1-432aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-432) |
Form : | Lyophilized powder |
AA Sequence : | MVILSLYLAAFTLRLLLAGLAHKHCRDAPDGAACHYFTSAERSEWRTEDPQFLAEVLFAV TSMLSFTRLASILPAHESLGTLQISMGRMIDDMIRFMFILMIILTAFLCGLNNIYVPYQE TERLGNFNETFQFLFWTMFGMEEHSVVDMPQFLVPEFVGRALYGIFTIVMVIVLLNMLIA MITNSFQKIEDAADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAIFYLLRRVFRFIC CCHFCCKTKKPDYPPIPTFANPGAGAGPGEGERGSYRLRVIKALVQRYIETAQREFEETR RKDLGNRLTELTKTVSRLQSEVAGVQRAVVEAGPRRPPGGASVLSRYITRVRNSFQNLGP PIPETPELTVPATVGTQESSEIGLPDAGGAQAPASGESGPSSPAHVLVHREQESEGAGDL PQEADLGAKEGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRPC2 |
Synonyms | TRPC2; TRP2; Short transient receptor potential channel 2 homolog; TrpC2; Transient receptor protein 2; TRP-2; bTrp2 |
UniProt ID | O62826 |
◆ Recombinant Proteins | ||
RFL9059PF | Recombinant Full Length Pan Paniscus Taste Receptor Type 2 Member 1(Tas2R1) Protein, His-Tagged | +Inquiry |
PLK1S1-1216H | Recombinant Human PLK1S1, GST-tagged | +Inquiry |
MOGAT1-6303HF | Recombinant Full Length Human MOGAT1 Protein, GST-tagged | +Inquiry |
ABT1-867HF | Recombinant Full Length Human ABT1 Protein, GST-tagged | +Inquiry |
BBS7-4606Z | Recombinant Zebrafish BBS7 | +Inquiry |
◆ Native Proteins | ||
Lectin-1815P | Active Native Peanut Lectin Protein, Cy5 labeled | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf57-1101HCL | Recombinant Human C2orf57 cell lysate | +Inquiry |
MS4A6A-4121HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
EHD3-6689HCL | Recombinant Human EHD3 293 Cell Lysate | +Inquiry |
C9orf86-7922HCL | Recombinant Human C9orf86 293 Cell Lysate | +Inquiry |
ORC4L-3551HCL | Recombinant Human ORC4L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TRPC2 Products
Required fields are marked with *
My Review for All TRPC2 Products
Required fields are marked with *
0
Inquiry Basket